Rat Secondary Antibodies
ABclonal Technology ABflo 488 Rat anti-Mouse CD3
This gene is predicted to enable identical protein binding and transmembrane signaling receptor activity playing a role in positive thymic T cell selection It is part of the alpha-beta T cell receptor complex and expressed in the thymus primordium Human orthologs are implicated in immunodeficiency 19 and severe combined immunodeficiency The gene is involved in nervous system development positive regulation of cell adhesion T cell activation cytokine production and signal transduction It is located in cellular components such as dendritic spines plasma membrane and immunological synapse The gene is expressed in the colon and hemolymphoid system Its human orthologs are implicated in immunodeficiency 18 The gene is orthologous to human CD3D and CD3E
CPC Scientific H-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH (trifluoroacetate salt) 1MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Cys10 and 26 bridge)MOLECULAR FORMULA: C146H239N47O44S3MOLECULAR WEIGHT:3453STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [133448-20-1], RESEARCH AREA: CardiovascularREFERENCES: M. Kojima et al., BBRC, 159, 1420 (1989)
Biotium Primary Antibody CD81 NA ExoBrite APC 1/EA
ExoBrite APC CD81 anti-mouse Flow Antibody is optimized for detection of the exosome marker CD81 in isolated exosomes by flow cytometry Recommended for instruments optimized for small particle flow 25 tests
Biotium CD86 (Dendritic Cells Maturation Marker)(C86/2160R), 0.2mg/mL
Recognizes a protein of 70 kDa, which is identified as CD86. CD86 is a type I transmembrane glycoprotein and a member of the immunoglobulin superfamily of cell surface receptors. It is expressed at high levels on resting peripheral monocytes and dendritic cells and at very low density on resting B and T lymphocytes. CD86 expression is rapidly upregulated by B cell specific stimuli with peak expression at 18 to 42 hours after stimulation. CD86, along with CD80/B71, is an important accessory molecule in T cell co-stimulation via its interaction with CD28 and CD152/CTLA4. Since CD86 has rapid kinetics of induction, it is believed to be the major CD28 ligand expressed early in the immune response. It is also found on malignant Hodgkin and Reed Sternberg (HRS) cells in Hodgkin's disease. Primary antibodies are available purified, or with a selection of fluorescent CF Dyes and other labels. CF Dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent
Biotium CD86 (Dendritic Cells Maturation Marker)(C86/2160R), CF405S conjugate, 0.1mg/mL
Recognizes a protein of 70 kDa, which is identified as CD86. CD86 is a type I transmembrane glycoprotein and a member of the immunoglobulin superfamily of cell surface receptors. It is expressed at high levels on resting peripheral monocytes and dendritic cells and at very low density on resting B and T lymphocytes. CD86 expression is rapidly upregulated by B cell specific stimuli with peak expression at 18 to 42 hours after stimulation. CD86, along with CD80/B71, is an important accessory molecule in T cell co-stimulation via its interaction with CD28 and CD152/CTLA4. Since CD86 has rapid kinetics of induction, it is believed to be the major CD28 ligand expressed early in the immune response. It is also found on malignant Hodgkin and Reed Sternberg (HRS) cells in Hodgkin's disease. Primary antibodies are available purified, or with a selection of fluorescent CF Dyes and other labels. CF Dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent
Biotium CD86 (Dendritic Cells Maturation Marker)(C86/2160R), Biotin conjugate, 0.1mg/mL
Recognizes a protein of 70 kDa, which is identified as CD86. CD86 is a type I transmembrane glycoprotein and a member of the immunoglobulin superfamily of cell surface receptors. It is expressed at high levels on resting peripheral monocytes and dendritic cells and at very low density on resting B and T lymphocytes. CD86 expression is rapidly upregulated by B cell specific stimuli with peak expression at 18 to 42 hours after stimulation. CD86, along with CD80/B71, is an important accessory molecule in T cell co-stimulation via its interaction with CD28 and CD152/CTLA4. Since CD86 has rapid kinetics of induction, it is believed to be the major CD28 ligand expressed early in the immune response. It is also found on malignant Hodgkin and Reed Sternberg (HRS) cells in Hodgkin's disease. Primary antibodies are available purified, or with a selection of fluorescent CF Dyes and other labels. CF Dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent
Biotium CD86 (Dendritic Cells Maturation Marker)(C86/2160R), CF740 conjugate, 0.1mg/mL
Recognizes a protein of 70 kDa, which is identified as CD86. CD86 is a type I transmembrane glycoprotein and a member of the immunoglobulin superfamily of cell surface receptors. It is expressed at high levels on resting peripheral monocytes and dendritic cells and at very low density on resting B and T lymphocytes. CD86 expression is rapidly upregulated by B cell specific stimuli with peak expression at 18 to 42 hours after stimulation. CD86, along with CD80/B71, is an important accessory molecule in T cell co-stimulation via its interaction with CD28 and CD152/CTLA4. Since CD86 has rapid kinetics of induction, it is believed to be the major CD28 ligand expressed early in the immune response. It is also found on malignant Hodgkin and Reed Sternberg (HRS) cells in Hodgkin's disease. Primary antibodies are available purified, or with a selection of fluorescent CF Dyes and other labels. CF Dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent
Biolegend APC/Cyanine7 anti-mouse CD182 (CXCR2)
APC/Cyanine7 anti-mouse CD182 (CXCR2) [SA044G4]; Isotype: Rat IgG2a, κ; Reactivity: Mouse; Apps: FC; Size: 25 ug
Biotium Lambda Light Chain (B-Cell Marker)(rLLC/1738), Biotin conjugate, 0.1mg/mL
This MAb is specific to lambda light chain of immunoglobulin and shows no cross-reaction with lambda light chain or any of the five heavy chains. In mammals, the two light chains in an antibody are always identical, with only one type of light chain, kappa or lambda. The ratio of Kappa to Lambda is 70:30. However, with the occurrence of multiple myeloma or other B-cell malignancies this ratio is disturbed. Antibody to the lambda light chain is reportedly useful in the identification of leukemias, plasmacytomas, and certain non-Hodgkin's lymphomas. Demonstration of clonality in lymphoid infiltrates indicates that the infiltrate is malignant. Primary antibodies are available purified, or with a selection of fluorescent CF Dyes and other labels. CF Dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent dyes like CF405S and CF405M are not recommended for detecting low abundance targets, because blue dyes have lower fluorescence and can giv
Cytek Biosciences Inc PE Rt IgG2b Iso Con Anti Isoty
Product Name: PE Rat IgG2b Isotype Control (LTF-2)
Product Class: Antibody
Type: Isotype Control
Product Name: PE Rat IgG2b Isotype Control (LTF-2)
Cytek Catalog Number: 50-4031-U100
Marker: Isotype Control
Clonality: Monoclonal
Clone: LTF-2
Host Species: Rat
Isotype: IgG2b
Conjugation: PE
Size: 100 μg
Biotium Human Lambda Light Chain (B-Cell Marker)(rLLC/3777), Biotin conjugate, 0.1mg/mL
This MAb is specific to lambda light chain of immunoglobulin and shows no cross-reaction with lambda light chain or any of the five heavy chains. In mammals, the two light chains in an antibody are always identical, with only one type of light chain, kappa or lambda. The ratio of Kappa to Lambda is 70:30. However, with the occurrence of multiple myeloma or other B-cell malignancies this ratio is disturbed. Antibody to the lambda light chain is reportedly useful in the identification of leukemias, plasmacytomas, and certain non-Hodgkin's lymphomas. Demonstration of clonality in lymphoid infiltrates indicates that the infiltrate is malignant. Primary antibodies are available purified, or with a selection of fluorescent CF Dyes and other labels. CF Dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent dyes like CF405S and CF405M are not recommended for detecting low abundance targets, because blue dyes have lower fluorescence and can giv
Biotium CD86(BU63), CF740 conjugate, 0.1mg/mL
Recognizes a protein of 70 kDa, which is identified as CD86. CD86, along with CD80/B71, is an important accessory molecule in T cell co-stimulation via its interaction with CD28 and CD152/CTLA4, a cancer immunotherapy target. It is a type I transmembrane glycoprotein and a member of the immunoglobulin superfamily of cell surface receptors. It is expressed at high levels on resting peripheral monocytes and dendritic cells and at very low density on resting B and T lymphocytes. CD86 expression is rapidly upregulated by B cell specific stimuli with peak expression at 18 to 42 hours after stimulation. Since CD86 has rapid kinetics of induction, it is believed to be the major CD28 ligand expressed early in the immune response. It is also found on malignant Hodgkin and Reed Sternberg (HRS) cells in Hodgkin's disease.Primary antibodies are available purified, or with a selection of fluorescent CF Dyes and other labels. CF Dyes offer exceptional brightness and photostability. N
Biolegend Spark PLUS B550TM Mouse IgG2a
Spark PLUS B550™ Mouse IgG2a, κ Isotype Ctrl [MOPC-173]; Isotype: Mouse IgG2a, κ; Apps: FC, ICFC; Size: 100 tests